Description
Involved in the removal of 5-formyltetrahydrofolate. In vitro, it is a potent inhibitor of various folate-dependent enzymes in the C1 metabolism network and in vivo it might function as a folate storage. 5-formyltetrahydrofolate is also used as an antifolate rescue agent in cancer chemotherapy. Catalyzes the irreversible ATP-dependent transformation of 5-formyltetrahydrofolate (5-CHO-THF) to form 5,10-methenyltetrahydrofolate (5,10-CH=THF). The reverse reaction is catalyzed by the serine hydroxymethyltransferase GlyA (SHMT).
Family
Belongs to the 5-formyltetrahydrofolate cyclo-ligase family.
Species
Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)
Sequence
MSPRSKSQLRTALLQNRRSVPEAVREGEAEALRGWLSGLKISGRTVCAYVPVGSEPGSIALLDTLLELGARVLLPVARNDAAGIPLPLQWGKYRPGTLVAAEFGLREPPPPWLPAETIGEADVILVPALAVDRSGARLGRGAGFYDRTLHHAAATAQVIAVVRDDELLDEIPAEPHDVAMTHVLTPKRGIVALR
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service