Component of the mitochondrial ribosome (mitoribosome), a dedicated translation machinery responsible for the synthesis of mitochondrial genome-encoded proteins, including at least some of the essential transmembrane subunits of the mitochondrial respiratory chain. The mitoribosomes are attached to the mitochondrial inner membrane and translation products are cotranslationally integrated into the membrane.

Belongs to the mitochondrion-specific ribosomal protein mL58 family.

195 amino acids

MIGRGVCCRSFHTAGSAWKQFGFPKTQVTTIYNKTKSASNYKGYLKHRDAPGMYYQPSESIATGSVNSETIPRSFMAASDPRRGLDMPVQSTKAKQCPNVLVGKSTVNGKTYHLGPQEIDEIRKLRLDNPQKYTRKFLAAKYGISPLFVSMVSKPSEQHVQIMESRLQEIQSRWKEKRRIAREDRKRRKLLWYQA

22.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make MRPL20 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here