This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Belongs to the universal ribosomal protein uL6 family.

177 amino acids

MSKIGKHPVAIPAGVTASVDGQTVKVKGPKGALEVVLVEEIQASLEGGELKIAMRGETPRHKSMWGMSRTLVANLVEGVTKGFEKKLEINGVGYKAAVAGKNLQLSLGYSHDVIYPIPEGIQIAAPKPTELVVTGINKQQVGQVAAEIREFRGPEPYKGKGVKYAGEFIFRKEGKKK

19 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rplF using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here