About Products Protein Database Contact

Protein expression services for rpl5 | 50S ribosomal protein L5

Description
This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. May contact the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.
Family
Belongs to the universal ribosomal protein uL5 family.
Species
Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
Length
185 amino acids
Sequence
MSETDSTFHEMREPQLEKVVVHMAVGEGGRELANAEEILQEIAGQTAVRTTATRAASQFGAREGDPIGAKVTLRGADAQSFLEKALPLVTISERQFDETGNFSFGVEEHTTFPSQEYDPQIGIYGLDVTVNLTRPGYRVTKRDKASQPIPSRHRLTPSDAVQFIESEFTVDITRVSADTRDGGDN
Mass
20.3 kDa
Simulated SDS-PAGE
Western blot of rpl5 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make rpl5 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here