Binds to 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome.

Belongs to the universal ribosomal protein uL23 family.

86 amino acids

MDSYSIIIKPHVTEKTMNLIDKNNEITFVVKRDANKGQIKRAFEELYEEKVARVTTHITPRGNKVAFIKLVEEEMAEELAVKIGVF

9.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rpl23 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here