The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome.

Belongs to the universal ribosomal protein uL22 family.

149 amino acids

MIKKKNKKRYTEVSALGKYIPMSTHKARRVIDQIRGRSYEETLMILELMPYRACYPILKLISSAAANGIHNMNFDETSLIISKAEVNEGPTAKKFKPRAKGQSYPIKRSTCHITIVLRDISLNEKYEEYIRKPWALLEKSNETEIRKRN

17.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rpl22-A using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here