One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.

Belongs to the universal ribosomal protein uL2 family.

239 amino acids

MGKSLIQQRRGKGSPTFRSPSHRFRGAVKYIPLNYTQDKTIRGVVEEIMHDPGRTAPVARVKFENGMEKLIIAPEGLLVGQEIYIGPDAPVEIGNTLPLAKIPEGTYIYNIEGVPGDGGKYVRAGGTYALVVSREKDKVIVQLPSGELKAFDPNCRATIGVVAGGGRLEKPLVKAGKAYYKYKARNKFWPTPRGVKMNAVNHPFGGKEHHPGKPTTTSRRAPPGRKVGHIAARRTGRRK

26.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rpl2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here