About Products Protein Database Contact

Protein expression services for rpl2 | 50S ribosomal protein L2

Description
One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome.
Family
Belongs to the universal ribosomal protein uL2 family.
Species
Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Length
239 amino acids
Sequence
MGKSLIQQRRGKGSPTFRSPSHRFRGAVKYIPLNYTQDKTIRGVVEEIMHDPGRTAPVARVKFENGMEKLIIAPEGLLVGQEIYIGPDAPVEIGNTLPLAKIPEGTYIYNIEGVPGDGGKYVRAGGTYALVVSREKDKVIVQLPSGELKAFDPNCRATIGVVAGGGRLEKPLVKAGKAYYKYKARNKFWPTPRGVKMNAVNHPFGGKEHHPGKPTTTSRRAPPGRKVGHIAARRTGRRK
Mass
26.1 kDa
Simulated SDS-PAGE
Western blot of rpl2 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make rpl2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here