This protein is located at the 30S-50S ribosomal subunit interface and may play a role in the structure and function of the aminoacyl-tRNA binding site.

Belongs to the bacterial ribosomal protein bL19 family.

127 amino acids

MDLIAQLEAEQIAALGKDIPDFKAGDTIRVGYKVTEGTRSRVQNYEGVCISRKNGSGIAGSFTVRKISFGEGVERVFPLYSTNIDSITVVRRGRVRRAKLYYLRARRGKSARIAEVANYKPKADAEA

14.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rplS using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here