This is one of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance.

Belongs to the universal ribosomal protein uL18 family.

200 amino acids

MAHGPRYRVPFRRRREGKTNYHKRLALLKSGKPRLVVRKTLNHHVAQIVLYAPEGDKTVVSAHTRELMRDFGWKGHGGNTPSAYLLGLLIGYKALEKGIEEAILDIGLHPPTKGSSIFAVLKGAVDAGLNVPHSEEIYPGEERINGKHIAEYAKMLKEDDENYKKQFGGYLVKGLEPEKLPEHFEEVKARIIEKFEKVRA

22.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rpl18 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here