This protein is one of the early assembly proteins of the 50S ribosomal subunit, although it is not seen to bind rRNA by itself. It is important during the early stages of 50S assembly.

Belongs to the universal ribosomal protein uL13 family.

142 amino acids

MRIINAEGLILGRLASKVAKMLLEGEEVVIVNAEKAIITGNREDIFAKYKQRTELRTRTNPRRGPFYPKRSDEIVRRTVRGMLPWKTDRGRKAFKRLKVYVGVPKEFEGKEFETISEAHMSRLATPKYVTVGEVAKFLGGKF

16.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rpl13 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here