Protein L1 is also a translational repressor protein, it controls the translation of its operon by binding to its mRNA.

Belongs to the universal ribosomal protein uL1 family.

212 amino acids

MKENIEEAVKKAVSEAPPRGFKESVDLAINLHNIDLTQPGNRVDTEVILPHGRGRPNRIAVFAAGDTALKAKAAGADYVISPEELKLLGENRKNARKLADEYDFFIAETQFMPVIGKTLGPILGKRGKMPTPLPPNADVAQMISRLKNIVRIRSRDRPTFHIAVGRRDMDARQLAENIESVITKLEQTLKDGRRNLKSVYVKTTMGPAVRVI

23.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rpl1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here