Binds directly to 23S rRNA. Might be involved in E site tRNA release (Potential).

Belongs to the universal ribosomal protein uL1 family.

240 amino acids

MVKIRSRRFKILQSQISVEKMCEPIEAINLLKSGPKAKFSETFEVHCCLDLNTKYSDQQLRASVVLPKGTGKRTKIAVITNEAEVNKIKNFGVDIVGSKDLVESIANGFLEFDQLLTTPDMMPVIAKVGKILGPRGLMPSPKSGSVTSDIYNAIQEFKKGKLEYRTDKSGIVHSIIGKIDFTAEDLLNNLIAIKKSIDQNRPNGAKGKYWKNMYLCTTMSPAIKIDFNKLQELEKNYGQN

26.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rpl1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here