Catalyzes the reduction of free flavins (FMN, FAD and riboflavin) by NADH. Subsequently, the reduced flavins diffuse to the large HpaB component or to other electron acceptors such as cytochrome c and Fe(3+) ion (By similarity).

Belongs to the non-flavoprotein flavin reductase family. HpaC subfamily.

170 amino acids

MQVDEQRLRFRDAMASLAAAVNIVTTAGHAGRCGITATAVCSVTDTPPSVMVCINANSAMNPVFQGNGRLCINVLNHEQELMARHFAGMTGMAMEERFHQPCWQNGPLGQPVLNGALAGLEGEISEVQTIGTHLVYLVAIKNIILSQDGHGLIYFKRRFHPVRLEMEAPV

18.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make hpaC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here