Catalyzes the ligation of 4-hydroxybenzoate, benzoate or cyclohex-1,4-dienecarboxylate and CoA at the expense of ATP. The enzyme shows low activity towards cyclo-2,5-dienecarboxylate, 4-fluorobenzoate, 4-chlorobenzoate and 2-methoxybenzoate.

Belongs to the ATP-dependent AMP-binding enzyme family. Benzoate-CoA ligase subfamily.

539 amino acids

MPLRDYNAAVDFVDRNVAEGRGGKIAFIDPQRSLSYGELRDAVARVGPMLARLGVEQENRIALVLKDTVDFPILFWGAIRAGIVPVLLNTRLTADQYRYLLEDSRSRVVFASSEFLPVIEEAAADLPHLRTIIAVGDAPAPTLQLANLLATEQEGGAPAATCADDIAYWQYSSGTTGMPKGVMHVHSSPRVMAENAGRRIGYREDDVVFSAAKLFFAYGLGNAMFCPMGIGATSVLYPERPTADSVFDTLRLHQPTLLFAVPTLYAAMLADPRSRTETLPDRLRLCVSAGEPLPAQVGLNWRNRFGHDIVNGVGSTEMGHLFLTNLPHAVEYGTSGVPVDGYRLRLVGDRGQDVADDEIGELLVSGGSSAAGYWNQRDKTRTTFVGEWTRTGDKYHRRADGVYTYCGRTDDIFKVSGIWVSPFEIEQALMSHAKVLEAAVIPAEDTDGLIKPKAFIVLASRGDIDPGALFDELKEHVKSAIGPWKYPRWIQIMDDLPKTSSGKLQRYLLREMTLGGIEATESAPSEPALYGRVVAGNGR

58.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make hbaA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here