Catalyzes the retro-aldol cleavage of 4-hydroxy-2-oxopentanoate to pyruvate and acetaldehyde. Is involved in the meta-cleavage pathway for the degradation of aromatic compounds.

Belongs to the 4-hydroxy-2-oxovalerate aldolase family.

338 amino acids

MSARSIHIVDTTLRDGSHAVSHQFTAEQIAAIAGGLDAAGVEYIEVSHGDGLAGSSYNYGWAALGDEEMLKAASAAIKKGKLTVLLLPGIGTVEDLKMAADCGAKVVRVATHVTEADIGEQHIGMAKKLGMMAVGFLMMCHMAPPEKVVEQAKLFESYGADYINIADSAGAMLPEDVKARVGAVVEAVKVPVGFHAHNNLTMATANALAAVEAGATFLDGACRGLGAGAGNAQTEALVGVLDKLGYRTGVDFYKVMDVAEDIVEPIMHRPQVVRNAPLMLGYAGVYSSFLLHTYRAAEKFNLDPRDILVELGRRRMVGGQEDMIVDVAYQLAQKRGGN

35.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Moth_1775 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here