Responsible for the formation of the pyrimidine heterocycle in the thiamine biosynthesis pathway. Catalyzes the formation of hydroxymethylpyrimidine phosphate (HMP-P) from histidine and pyridoxal phosphate (PLP). The protein uses PLP and the active site histidine to form HMP-P, generating an inactive enzyme. The enzyme can only undergo a single turnover, which suggests it is a suicide enzyme.

Belongs to the NMT1/THI5 family.

346 amino acids

MSTNKITFLTNWEATPYHLPIFLAQTRGYYEREGIEVAILEPTNPSDVTALIGSGKVDMGLKAMIHTLAAKARGYPVTSFGSLLNEPFTGLITLKGNGINDFKDIKGKRIGYVGEFGKIQLDDLCSKFGLSPSDYTAIRCGMNIAPAIINGEIDGGIGIECMQQVELERWCVSQGRPRSDVQMLRIDRLANLGCCCFCTILYIAHDEFIAKHPDKIKAFLRAIHSATLDMLKDPVQTYKEYIHFKREMGSELHREQFERCFAYFSHDISNVPRDWNKVTNYSKRLGIIPQDFEPNCTNGYLTWELDPDEKDPMGKQEAIAEIQDEIKQKGGVFSGNSLRYVEPANL

39 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make nmt1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here