Description
Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. Plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. May play a role in cell fate determination and tissue morphogenesis.
Family
Belongs to the universal ribosomal protein uS2 family.
Sequence
MSGGLDVLQMKEEDVLKFLAAGTHLGGTNMDFQMEHYTYKRKSDGVYIINLKKTWEKLLLAARAIVAIENPADVCVISSRNTGQRAVLKFASATGATTFHGRFTPGTFTNQIQAAFREPRLLIVTDPRADHQPLTEASYVNIPTIAMCNTDSPLRYVDIAIPCNNKGHHSVGLMWWMLSREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEEQAAAEKAVGKEEFQGEWTAPTADFAQPEVADWSEGVAVPSVPIQQFPAGIEGKSFTEAAAPSKAPAAAEGFAEDWSAQPATEDWSAAPTAQATEWGGASADWS
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service