Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits.

Belongs to the universal ribosomal protein uS2 family.

263 amino acids

MSNKKGQSPKEESIAKMLICKVHIGTKNLENKMKRYVYTRAKDGVHIINLAKTYEKLQLAARIIVAISNPADVVVVSARPFGSRAVLKFAQYTGAQAIAGRWTPGMLTNQIIQKFTEPRLLIVTDPRTDAQSVKESAYANIPVIALCDSDSPLEHVDIAIPCNNKGKESIALMYWLLAQEVLYLKGVIPRSEPWNVMVDMFLWRDPEQFELKNLANEENTPTAPHLIENQYAAEAPYDEWTKKEEWNDNTNEDWKNPIAAEEW

29.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make PF10_0264 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here