Elimination of the ALEP-1 gene from all somatic cells in its fully activate state may represent an alternative way to gene regulation.

Belongs to the eukaryotic ribosomal protein eS19 family.

148 amino acids

MVKATSVKDVDQHEIVQHIAKFLKKSGKVKVPEWSDVTKMGISKELAPLNSDWYYVRTASIARRLYVRSPTGVDALRLVYGGSKRRGVVPNHFAKASGSVIRKALQTLEAIKWVQKHPDGNGRVLTKQGRKDLDRIASQMRQNDRFTA

16.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make RPS19G using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here