Protein expression services for RPS0 | 40S ribosomal protein S0
Description
Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits.
Family
Belongs to the universal ribosomal protein uS2 family.
Species
Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
Length
293 amino acids
Sequence
MAPANLPSIFNATSTDIEQLLAAQCHVGSKNLGVNMQPYLWKTRADGVNVINIGKTWEKITLAARIIAAIDNPSDVCVISARPYGQRAVLKFAAHTGAQAIAGRFTPGSFTNYITRSFKEPRLIIVTDPRTDSQAIKEASYVNIPVIALCDTDSPTEYVDVAIPTNNKGRHSIGLVWWMLAREVLRLRGTIYNRETPWDVMPDLYFYRDPEAEAEEKVEEEKVPGVEEEGPVAIESGFPAGGADWEAAPAGFPAAATGEWSEAQPATWESGAAAATGPSTEWADSAPKDTAGW
Mass
31.7 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make RPS0 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here