Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. KAS III catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities (By similarity).

Belongs to the thiolase-like superfamily. FabH family.

404 amino acids

MANASGFFTHPSIPNLRSRIHVPVRVSGSGFCVSNRFSKRVLCSSVSSVDKDASSSPSQYQRPRLVPSGCKLIGCGSAVPSLLISNDDLAKIVDTNDEWIATRTGIRNRRVVSGKDSLVGLAVEAATKALEMAEVVPEDIDLVLMCTSTPDDLFGAAPQIQKALGCTKNPLAYDITAACSGFVLGLVSAACHIRGGGFKNVLVIGADSLSRFVDWTDRGTCILFGDAAGAVVVQACDIEDDGLFSFDVHSDGDGRRHLNASVKESQNDGESSSNGSVFGDFPPKQSSYSCIQMNGKEVFRFAVKCVPQSIESALQKAGLPASAIDWLLLHQANQRIIDSVATRLHFPPERVISNLANYGNTSAASIPLALDEAVRSGKVKPGHTIATSGFGAGLTWGSAIMRWR

42.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make At1g62640 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here