Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Specific for elongation from C-10 to unsaturated C-16 and C-18 fatty acids.

Belongs to the thiolase-like superfamily. Beta-ketoacyl-ACP synthases family.

405 amino acids

MRRVVITGLGIVSCLGNDKDTVSANLRAGRPGIRFNPSYAEMGLRSHVSGSVDLNLEELIDRKVFRFMGDAAAYAYLAMEQAIKDSGLTPEQISNPRTGLIAGSGGASTLNQMEAIDTLREKGVKRIGPYRVTRTMGSTVSACLATPFQIKGVNYSISSACATSAHCIGQAMEQIQLGKQDVVFAGGGEEEHWSQSCLFDAMGALSTQYNETPEKASRAYDAKRDGFVIAGGGGMVVVEELEHALKRGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQQALATVDAPIDYLNTHGTSTPVGDVAEIRGVREVFGDKAPAISSTKSLSGHSLGAAGVHEAIYCLLMMEGGFIAGSANIDELDPEVADLPILRETRENAKLDTVMSNSFGFGGTNATLVLKRWQG

42.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make fabB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here