Catalyzes the reversible reaction in which hydroxymethyl group from 5,10-methylenetetrahydrofolate is transferred onto alpha-ketoisovalerate to form ketopantoate.

Belongs to the PanB family.

286 amino acids

MATKLPTTDIRIGAELIRRRKGGVPLVCLTAYTYPVARLLDPHVDLLLVGDSVSMVLHGHATTLGASLGMMIAHGQAVMRGSARACVVVDMPAGSYEDSAAQAVASARRIVDETGCQAVKLEGGVDMAGQIAAIAAAGIPVMGHIGLLPQSVEKDGGYKIKGRTDETVAALMADARAVEKAGAFSVVIEGTIEAVAADITRRIAIPTIGIGASGDCDGQILVIDDMVGLTVDRVPKFVKEYADLRSVIANAAERYAAEVRDRTFPGPSHVFSGSKASSDLNGGDES

29.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make panB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here