Catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS). Required for sphingolipid biosynthesis. In plants, sphingolipids seems to play a critical role in mineral ion homeostasis, most likely through their involvement in the ion transport functionalities of membrane systems in the root. Is stereospecific for D-erythro-DHS production and does not produce L-threo-DHS.

Belongs to the short-chain dehydrogenases/reductases (SDR) family.

331 amino acids

MAAIFSLFLFFILFIVSLLIILSFIVRPRSVTIPIKFRHVFITGGSSGIGLALAHRAVSEGAKVSILARSTEKLAEAKRSIQLATGVEVATFSADVRDYDAVSKAIDESGPIDVLIVNQGVFIGKELEKQSPEEVKFMIDVNLTGSFNVIKAALPAMKAREGRGPASISLVSSQAGQAGIYGYTAYSASKFGLQGLAQALQQEVISDGIHVTLLFPPDTDTPGFEQELKKRPELTSIIAASSGSMKTNEVAKICFDGIKAGKFTVTCHFIGFLLSIASTGMSPQGSFWLALTEVMFGGLIRLASLVFQWQWYKTIEKWSQRNKKEVNSKLA

35.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make TSC10B using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here