Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Regulates the flux of sulfur in the sulfur-activation pathway by converting PAPS to APS. Is also able to hydrolyze inositol 1,4-bisphosphate and inositol 1,3,4-trisphosphate (By similarity).

Belongs to the inositol monophosphatase superfamily.

332 amino acids

MSLCNLAKIRSVAIKAVEKACIACLDIQKQLISEDTINKKDQSPVTVGDYTVQALVINELLKGLDEEYPIIAEEDSKTLSSQKDVESKVLSFFNRYSNESFVESQLSSLLDKGNKKKDLNSSNRWWTLDPIDGTLGFLRKDQYAVALALMEDNKPILGILGCPNLPVSKGSTEKGCIFVGLKNKGSFMIKLSNLDQEEPIKVSNQSDPTKAIFTESFVSRGFGHELNQKISNSMGVTAEPLKIDSQCKYAMVARGDSDCYLRLTQLDYKECIWDHAAGHIIVEEAGGIVTDFKKQQLDYSKGFKLENNVGIVCSNKLLNDSLFDSIKKSIQF

36.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make DDB_G0268652 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here