Protein expression services for fkbM | 31-O-demethyl-FK506 methyltransferase FkbM
Description
Involved in the biosynthesis of FK506, which is a macrolide antibiotic with immunosuppressant activity. Catalyzes the transfer of a methyl group from S-adenosyl-L-methionine to the 31-O-position of 31-O-demethyl-FK506. Also catalyzes the methylation of 31-O-demethylimmunomycin, the C31 transmethylation reaction of 13,31-O-bis-demethyl-, 15,31-O-bisdemethyl-, 13,15,31-O-trisdemethyl- and 31-O-19,22-cyclic-hemiketalimmunomycins, which are all structural analogs of FK506.
Family
Belongs to the FkbM methyltransferase family.
Species
Streptomyces tacrolimicus
Length
260 amino acids
Sequence
MSDVVETLRLPNGATVAHVNAGEAQFLYREIFTDRCYLRHGVELRPGDVVFDVGANIGMFMLFAHLEHPGVTVHAFEPAPVPFAALRANAVRHRVAGRVDQCAVSDEAGVRRMTFYPDATLMSGFHPDAAARKELLRTLGLNGGYTAEDVDMMLAQLPDTGEEIETSVVRLSDVIAERGIAAIGLLKIDVEKSERRVLAGVEDADWPRIRQVVAEVHDVDGALGEVVALLRGHGFTVVAEQDPLFAGTEIHQVAARRTAG
Mass
28.2 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make fkbM using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here