One of the primary rRNA binding proteins, it binds directly to 16S rRNA central domain where it helps coordinate assembly of the platform of the 30S subunit.

Belongs to the universal ribosomal protein uS8 family.

133 amino acids

MVNLNPLANALTTIYNNEMRRNKQAIIMPASKLIINVLRAMQKEGYIGEFEFIDDGRSGKIVVQLLGRINKCGPIAPRYPLKYKDLLTLPDYVRRYLPSKEIGVLIISTNKGVMTHKDAIRERIGGVALGYVY

15 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rps8 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here