Located at the back of the 30S subunit body where it stabilizes the conformation of the head with respect to the body.

Belongs to the universal ribosomal protein uS5 family.

172 amino acids

MAKMQAKVQADERDDGLREKMISVNRVTKVVKGGRILGFAALTVVGDGDGRVGMGKGKAKEVPVAVQKAMEQARRNMFKVPLKNGTLQHEVHGKHGASTVLLAPAKDGTGVIAGGPMRAVFDVMGVQNVVAKSHGSTNPYNLVRATLDGLRKQSTPGDIAAKRGKSVEEILG

18.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rpsE using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here