In the hcf60 mutation the Activator tag is inserted 17 base pars upstream of the initiation codon. This mutation is seedling lethal, due to plastid ribosome insufficiency. However under non-light stressed conditions photosynthesis and oxygen evolution can occur.

Belongs to the universal ribosomal protein uS17 family.

132 amino acids

MLLLSSPFVSVSPPPPPLSSHGARPALRIEAARQLTGRVVTTKADKTVGVEVVRLAPHPKYKRRERIKKKYQAHDPDNQFKVGDVVELQPSRPISKTKHFLAIPLPPRDTRRKSQLLPPLQSDDDQEPSSRE

14.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make RPS17 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here