About Products Protein Database Contact

Protein expression services for rps13 | 30S ribosomal protein S13

Description
Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement.
Family
Belongs to the universal ribosomal protein uS13 family.
Species
Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / NBRC 14720 / NCIMB 2260 / Gabara)
Length
170 amino acids
Sequence
MSTEEPQADEEDEDLQYFVRIGQTDLDGTKSVERALTDMNGIGRRVARIIAEKAEVDRRDVLGALDEEKIDDVVAAVEEYGDEVPEWLTNHQKDFFTGETTHEIGNDLQMSRRQDINRMKKIDAYRGVRHKRGQKVRGQRTKSTGRTEGTIGVNVEAIKEEQAEDGGDEE
Mass
19.3 kDa
Simulated SDS-PAGE
Western blot of rps13 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make rps13 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here