Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement.

Belongs to the universal ribosomal protein uS13 family.

170 amino acids

MSTEEPQADEEDEDLQYFVRIGQTDLDGTKSVERALTDMNGIGRRVARIIAEKAEVDRRDVLGALDEEKIDDVVAAVEEYGDEVPEWLTNHQKDFFTGETTHEIGNDLQMSRRQDINRMKKIDAYRGVRHKRGQKVRGQRTKSTGRTEGTIGVNVEAIKEEQAEDGGDEE

19.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rps13 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here