Involved in the binding of tRNA to the ribosomes.

Belongs to the universal ribosomal protein uS10 family.

104 amino acids

MASYKARISLSGTEHKIVDMVCSEIKEIASRTGVEIHGPMPLPTKKLVVPVRKSPDGEGTNTWDHWEMRIHKRLIDVDADERTLRQLMRIPIPDGVQIEIQIKS

11.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rps10 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here