Component of the chloroplast ribosome (chloro-ribosome), a dedicated translation machinery responsible for the synthesis of chloroplast genome-encoded proteins, including proteins of the transcription and translation machinery and components of the photosynthetic apparatus (PubMed:10874039, PubMed:28007896). Actively engaged in the initiation complex formation via a strong mRNA-binding activity. Possesses a poly(A)-binding activity which might play a role as a control element in chloroplast mRNA translation (PubMed:1527032).

Belongs to the bacterial ribosomal protein bS1 family.

411 amino acids

MASLAQQLAGGLRCPPLSNSNLSKPFSPKHTLKPRFSPIVSAVAVSNAQTRERQKLKQLFEDAYERCRNAPMEGVSFTIDDFHTALDKYDFNSEMGSRVKGTVFCTDANGALVDITAKSSAYLPLAEACIYRIKNVEEAGIIPGVREEFVIIGENEADDSLILSLRQIQYELAWERCRQLQAEDVVVKGKIVGANKGGVVALVEGLRGFVPFSQISSKSSAEELLEKEIPLKFVEVDEEQSRLVMSNRKAMADSQAQLGIGSVVTGTVQSLKPYGAFIDIGGINGLLHVSQISHDRVSDIATVLQPGDTLKVMILSHDRERGRVSLSTKKLEPTPGDMIRNPKLVFEKAEEMAQTFRQRIAQAEAMARADMLRFQPESGLTLSSDGILGPLTSDLPAEGLDLSVVPPAVES

44.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make RPS1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here