Required for optimal plastid performance in terms of photosynthesis and growth. Required for the translation of plastid mRNAs (PubMed:22900828). Involved in cellular heat stress response and required for heat tolerance. Required for transcriptional activation of HSFA2 and its target genes in response to heat stress. Plays a critical role in biosynthesis of thylakoid membrane proteins encoded by chloroplast genes (PubMed:22570631).

Belongs to the bacterial ribosomal protein bS1 family.

416 amino acids

MASLAQQFSGLRCSPLSSSSRLSRRASKNFPQNKSASVSPTIVAAVAMSSGQTKERLELKKMFEDAYERCRTSPMEGVAFTVDDFAAAIEQYDFNSEIGTRVKGTVFKTDANGALVDISAKSSAYLSVEQACIHRIKHVEEAGIVPGMVEEFVIIGENESDDSLLLSLRNIQYELAWERCRQLQAEDVIVKAKVIGANKGGLVALVEGLRGFVPFSQISSKAAAEELLEKEIPLKFVEVDEEQTKLVLSNRKAVADSQAQLGIGSVVLGVVQSLKPYGAFIDIGGINGLLHVSQISHDRVSDIATVLQPGDTLKVMILSHDRDRGRVSLSTKKLEPTPGDMIRNPKLVFEKAEEMAQTFRQRIAQAEAMARADMLRFQPESGLTLSSDGILGPLGSELPDDGVDLTVDDIPSAVDI

45.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make RPS1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here