Protein expression services for Jmjd4 | 2-oxoglutarate and iron-dependent oxygenase JMJD4
Description
Catalyzes the 2-oxoglutarate and iron-dependent C4-lysyl hydroxylation of ETF1 at 'Lys-63' thereby promoting the translational termination efficiency of ETF1 (By similarity). Not essential for embryonic stem cell (ESC) maintenance and the embryonic and postnatal development (PubMed:27147518).
Species
Mus musculus
Length
427 amino acids
Sequence
MDRETRTFAERYYRDLRDPVPSGGGGPTPSGVTFIQTPNAFSYADFVKGFLLPNLPCVFSSAFTEGWGSRRRWVTSEGKPDFEYLQQKYGDAVVPVANCGVREYNSNPKEHMSFRDYISYWKDYIQGSYSSSRGCLYLKDWHLCRDSLVNDLEDIFTLPVYFSSDWLNEFWDVLNVDDYRFVYAGPRGTWSPFHADIFRSFSWSVNICGKKKWLFFPPGEEEALRDCHGNLPYDVTSTELLDTHLYPKIQHHSLPIEVIQEPGEMVFVPSGWHHQVYNLDDTISINHNWVNGCNLPNMWHFLQQELQAVQHEVEEWKDSMPDWHHHCQVIMKSCTGINFEEFYHFLKVIAEKRLLVLEQGLKGDSGDSRSLDLGLQQAAFDIGRLADVLASVVVNPDFQRVDTSAFSPQPEELLQQLEDAVAAAEAL
Mass
49.2 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Jmjd4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here