Catalyzes an unusual C-C bond hydrolysis of 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoic acid (HOPDA) to produce benzoic acid and 2-hydroxy-2,4-pentadienoic acid (HPD).

Belongs to the AB hydrolase superfamily. BphD family.

286 amino acids

MTALTESSTSKFVKINEKGFSDFQIHYNEAGNGETVIMLHGGGPGAGGWSNYYRNIGAFVEAGYRVILKDSPGFNKSDAVVMDEQRGLVNARAVKGLMDALDIDRAHLVGNSMGGATALNFALEYPDRIGKLILMGPGGLGPSMFAPMPMEGIKLLFKLYAEPSYETLKQMLQVFLYDQSLITEELLQGRWEAIQRNPEHLKNFLVSAQKAPLSTWDVSARLGEIKAKTFITWGRDDRFVPLDHGLKLVWGINDARLHVFSKCGHWAQWEHADEFNRLVIDFLRHA

31.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make bphD using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here