Catalyzes the conversion of sedoheptulose 7-phosphate to 2-epi-valiolone, which may serve as an alternative precursor for aminocyclitol biosynthesis.

Belongs to the sugar phosphate cyclases superfamily. EVS family.

382 amino acids

MDSPAGYRIHDNIPLPGNLDQVDVHVTRDDDYRIHVLPDVDRAVDALLTELDGRRAVVITDDVVADLHEGRVSAELAARGQLIGRTAIRAGEKSKSLTTAFELIDWLAEVNLARRDVVIALGGGVVVDTVGFVASAYMRGVPYVNMPTTLLAQVDAGIGGKVAVDHSEAKNLVGAFYQPKAVISCLEHLRTLDTRQIRSGLAEVVKKAVIASPELFDYIEANADDLLACASPAIDVLVHAAGAIKTKLVGRDPYEIDLRRPLNFGHTTGHAVETVTNYGPVLHGEAVAFGMVVAVDVARARGLVVPEVADRVTALIRRLGLPVALEELGAVPRVDDVVAALLKIRQIRDGSLRFVLPVELGATVIAEDVTEEEVRAALVRLR

41 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Amir_2000 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here