This enzyme confers resistance to kanamycin, gentamicin, dibekacin, sisomicin, neomycin and tobramycin by adenylating the 2''-hydroxyl group of these antibiotics.

177 amino acids

MDTTQVTLIHQILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAMVEMLGGRVTEELDYGFLAEIGDELLDCEPAWWADEAYEIAEAPQGSCPEAAEGVIAGRPVRCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLGAEKVEVLRAAFRSRYAA

19.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make aadB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here