Protein expression services for cnbZ | 2-amino-5-chloromuconate deaminase
Description
Involved in the biodegradation of xenobiotic compounds, such as nitrobenzene and 4-chloronitrobenzene (4-CNB) (PubMed:16517619). CnbZ preferentially catalyzes the deamination of 2-amino-5-chloromuconate (2A5CM) to yield 2-hydroxy-5-chloromuconate (2H5CM). Also able to catalyze the deamination of 2-aminomuconate to yield 2-hydroxymuconate, which spontaneously converts into its keto form, 2-oxalocrotonate.
Species
Comamonas testosteroni
Length
251 amino acids
Sequence
MPDAVVFSPGGYRYIPAVFQYSAGIAAEPGFEIERVRFHRPVPLAEAFVAVESHLRAIGRPTTSFAQCELRSPDPFNDQGFIDFNTEYVKTLERWGIYKDRVNPVARTNVCPMYDKPTTPSMFAFSYTVPTTSAAKRPSFQLAGGGDARGGSAPYKDRIVAFGDTSPEGLREKVVFVIEEMESRLKTLGLGWADAVSTQLYTVQNIGHLVGPELARRGCGAGGLVWNYTRPPVIGLEYEMDVRGAVRETVL
Mass
27.6 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make cnbZ using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here