The 26S proteasome is involved in the ATP-dependent degradation of ubiquitinated proteins. The regulatory (or ATPase) complex confers ATP dependency and substrate specificity to the 26S complex (By similarity).

Belongs to the AAA ATPase family.

428 amino acids

MVNKEDVEDELLNETAPVALDEGDIALLKSYGVGPYSKSIRILEEDIKKMTSKVNELCGIKESDTGIGPPSQWDLVVDKTSAHEEPPLQVARCTKIIDVGKPNAKYIITVKQIAKFVVALGDKLSPTDVEEGIRVGVDRNKYQIQIPLPPKIDASVTMMQVEEKPDITYKDVGGCKEQIEKLREVVEMPLLHPEKFVNLGIDPPKGVLMYGPPGTGKTLCARAVANRTDAAFVRVIGSELVQKYVGEGARMVRDLFQMARSKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALLRPGRLDRKVEFGLPDLEGRAHIFTIHAKTMSCARDIRFELLARLCPNSTGADIRSVCTEAGMFAIRARRKVVSEKDFLEAIDKVIKSYAKFSATSRYMHYN

47.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make psmC2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here