S-adenosyl-L-methionine-dependent methyltransferase that specifically methylates the N(1) position of adenine in helix 25.1 in 25S rRNA. Required both for ribosomal 40S and 60S subunits biogenesis. Required for efficient pre-rRNA cleavage at site A2 (By similarity).

Belongs to the methyltransferase superfamily. RRP8 family.

318 amino acids

MFKVDWDLGPVSKSASDQTKESRKEKKRKKGERKNVGDKGEKLNEKVLKKAKSVTTNNSLKSEIKKEKSVPSIKEKNKGDAKHTKLTSLQQKMKDKLDGANFRWINEQLYTTESDKAVQMFKENPDLFDIYHAGFRYQVEGWPENPVDIFIQHLKIRFEHSNAKKKNNIVIADLGCGEAKIASTFRKSRSLQVHSFDLVAPNEHVVACDIANVPMADETVDIAVFCLSLMGTNWQSFLKEAYRILKVGGLLWVAEIKSRFSDKSGEVFAKELPKLGFETKSIQLQNKMFTLFEFKKVPVHGKCEELPPILSACIYKRR

36.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rrp8 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here