Prostaglandin inactivation. Contributes to the regulation of events that are under the control of prostaglandin levels. Catalyzes the NAD-dependent dehydrogenation of lipoxin A4 to form 15-oxo-lipoxin A4 (By similarity).

Belongs to the short-chain dehydrogenases/reductases (SDR) family.

265 amino acids

MHVNGKVALVTGAAQGIGRAFAEGLLHKGAKVALVDWNLEAGVKCKAALDEEFEPQKTLFIQCDVADQEQLRDTFTKVVDYFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQHGGEGGVIINMSSLAGLMPVAQQPVYCASKHGIIGFTRSAAMARKLMNSGVRMNAICPGFVNTSILQSIEKEENMGPYIEYTGHIKDMMKCYGILDPEMIANGLITLIEDDDLNGAIMKITTSNGIHFQDYDTAPSYAKD

28.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make HPGD using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here