Is associated with a DNA binding complex that binds to the G box, a well-characterized cis-acting DNA regulatory element found in plant genes (PubMed:7972511, PubMed:7870824, PubMed:16407442). Involved in the regulation of nutrient metabolism (PubMed:22104211, PubMed:21094157). Reciprocal negative transcription regulation of miR396 (PubMed:22751317). Negative regulator of constitutive freezing tolerance and cold acclimation by controlling cold-induced gene expression partially through an ethylene (ET)-dependent pathway; prevents ethylene (ET) biosynthesis, probably by binding 1-aminocyclopropane-1-carboxylate synthases (ACS) to reduce their stability, thus contributing to establish adequate ET levels under both standard and low-temperature conditions (PubMed:25122152).

Belongs to the 14-3-3 family.

255 amino acids

MSTREENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELSVEERNLLSVAYKNVIGARRASWRIISSIEQKEESKGNEDHVAIIKDYRGKIESELSKICDGILNVLEAHLIPSASPAESKVFYLKMKGDYHRYLAEFKAGAERKEAAESTLVAYKSASDIATAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDDAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMTDEAGDEIKEASKPDGAE

28.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make GRF3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here