Protein expression services for 14-3-3zeta | 14-3-3 protein zeta
Description
Required in Raf-dependent cell proliferation and photoreceptor differentiation during eye development (PubMed:9159395). Acts upstream of Raf and downstream of Ras, and is essential for viability (PubMed:9159395). Acts as a negative regulator of the slo calcium channel via its interaction with slo-binding protein slob (PubMed:10230800). Inhibits yki activity by restricting its nuclear localization (PubMed:19900439). Binds to and promotes the activity of phosphoinositide 3-kinase Pi3K68D which converts phosphatidylinositol to phosphatidylinositol-3-phosphate and promotes maturation of early endosomes (PubMed:27015288).
Family
Belongs to the 14-3-3 family.
Species
Drosophila melanogaster
Length
248 amino acids
Sequence
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
Mass
28.2 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make 14-3-3zeta using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here