Involved in the biosynthesis of melanin but also various secondary metabolites containing a naphthoquinone ring. Catalyzes the iterative condensation of five CoA-linked malonyl units to form a pentaketide intermediate. THNS subsequently catalyzes the dual intramolecular Claisen and aldol condensations of this linear intermediate to produce the fused ring of 1,3,6,8-tetrahydroxynaphthalene (THN).

Belongs to the thiolase-like superfamily. Chalcone/stilbene synthases family.

377 amino acids

MRVPVAVDDLVAPSTMGERHTVIDRGTSVAAVHTALPPHRYAQSDLTELIADLCLEPGADRALLRRLHTSAGVRTRHLALPIEQYAGLGDFGQANAAWLTVGLALAEEALSGALDAAGLTAADIDLLVCTSITGVAAPSLDARLAVRMGMRADVKRVPVFGLGCVGGAAGLGRLHDYLLGHPDDTAVLLSVELCSLTLQRDGSLANLVAGALFGDGAAAVVARGGDAGRRGAGWPMVAATRGHLYPDTEHLLGWRIGASGFRVVVDAGIPDVVRTHLGGDLRNFLATHGLVPDDIGTWICHPGGPKVLAAVGDALELPDGALDSSWRSLAGVGNLSSASVLRVLEDVATRCRPDPGTWGVLLAMGPGFCAEFVLLRW

39.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rppA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here