Seems to function only as a co-chaperone, along with CPN60, and in certain cases is essential for the discharge of biologically active proteins from CPN60.

Belongs to the GroES chaperonin family.

98 amino acids

MMKRLIPTFNRILVQRVIQPAKTESGILLPEKSSKLNSGKVIAVGPGSRDKDGKLIPVSVKEGDTVLLPEYGGTQVKLGENEYHLFRDEDVLGTLHED

10.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make CPN10 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here