Zbtb8os

Protein archease

168 amino acids

Component of the tRNA-splicing ligase complex required to facilitate the enzymatic turnover of catalytic subunit RTCB. Together with DDX1, acts by facilitating the guanylylation of RTCB, a key intermediate step in tRNA ligation (By similarity).

Belongs to the archease family.

19.727 kDa

MAQEEEDVRDYNLTEEQKATKDKYPPVNRKYEYLDHTADVQLHAWGDTLEEAFEQCAMAMFGYMTDTGTVEPLRTVEVETQGDDLQSLLFHFLDEWLYKFSADEYFIPREVKVLNIDQKNFKLRSIGWGEEFSLSKHPQGTEVKAITYSAMQVYNEEKPEVFFVIIDI

ZBTB8OS

Protein archease

167 amino acids

Component of the tRNA-splicing ligase complex required to facilitate the enzymatic turnover of catalytic subunit RTCB. Together with DDX1, acts by facilitating the guanylylation of RTCB, a key intermediate step in tRNA ligation.

Belongs to the archease family.

19.491 kDa

MAQEEEDVRDYNLTEEQKAIKAKYPPVNRKYEYLDHTADVQLHAWGDTLEEAFEQCAMAMFGYMTDTGTVEPLQTVEVETQGDDLQSLLFHFLDEWLYKFSADEFFIPREVKVLSIDQRNFKLRSIGWGEEFSLSKHPQGTEVKAITYSAMQVYNEENPEVFVIIDI

ZBTB8OS

Protein archease

167 amino acids

Component of the tRNA-splicing ligase complex required to facilitate the enzymatic turnover of catalytic subunit RTCB. Together with DDX1, acts by facilitating the guanylylation of RTCB, a key intermediate step in tRNA ligation (By similarity).

Belongs to the archease family.

19.432 kDa

MALEGEDVRDYNLTEEQKAIKAKYPPVSRKYEYLDHTADVQLHAWGDTLEEAFEQCAMAMFGYMTDTGTVEPLQTIEVETQGDDLQSLLFHFLDEWLYKFSADEFFIPREVKVLNIDQRNFKIRSIGWGEEFSLSKHPQGTEVKAITYSAMQVYNEEKPEVFVIIDI

zbtb8os

Protein archease

162 amino acids

Component of the tRNA-splicing ligase complex required to facilitate the enzymatic turnover of catalytic subunit RTCB. Together with ddx1, acts by facilitating the guanylylation of RTCB, a key intermediate step in tRNA ligation (By similarity).

Belongs to the archease family.

19.02 kDa

MNDRELDLTEEQKALKAKYPPITKKYEYLDHTADVQIHSWGNSLEEAFEQCAMGMFGYMTDTETVEPIDTVEVESEGDDMESLLYHFLDDWLFKFSADIFFIPREVKVLHIDRMRYKIRSIGWGEEFSINKHPQGTEVKAITYSAMQIHETEQPEIFVIIDI