About Products Protein Database Contact

yosW

Gene
yosW
Protein
SPbeta prophage-derived uncharacterized membrane protein YosW
Organism
Bacillus subtilis (strain 168)
Length
113 amino acids
Mass
12.927 kDa
Sequence
MIMRGESNTYIKVKSVLDNSTPEDAKRNKNLIYLFTLLKGSSLIIPLAYNGLIMHENILILCWTAFSVIYTVLSMFKVLDVLEGETVSHSRYIYLAYVFGNLIFALSIIFHIM