yopT

Cysteine protease YopT

322 amino acids

Cysteine protease, which is translocated into infected cells and plays a central role in pathogenesis by cleaving the C-terminus end of the human small GTPase RhoA/ARHA, a regulator of cytoskeleton. Once cleaved, ARHA loses its lipid modification, and is released from the cell membrane, leading to the subsequent disruption of actin cytoskeleton of the host cell (By similarity).

Belongs to the peptidase C58 family.

36.439 kDa

MDSIHGHYHIQLSNYSAGENLQSATLTEGVIGAHRVKVETALSHSNRQKKLSATIKHNQSSRSMLDRKLTSDGKANQRSSFTFSMIMYRMIHFVLSTRVPAVRESVANYGGNINFKFAQTKGAFLHQIIKHSDTASGVCEALCAHWIWSHAQGQSLFDQLYVGGRKGKFQIDTLYSIKQLQIDGCKADVDQDEVTLDWFKKKGISERMIERHCLLRPVDVTGTTESEGPDQLLNAILDTHGIGYGYKKIYLSGQMSAHAIAAYVNEKSGVTFFDPNFGEFHFSDKEKFRKWFTNSFWENSMYHYPLGVGQRFSVLTFDSKEV

yopT

Cysteine protease YopT

322 amino acids

Cysteine protease, which is translocated into infected cells and plays a central role in pathogenesis by cleaving the C-terminus end of the human small GTPase RhoA/ARHA, a regulator of cytoskeleton. Once cleaved, ARHA loses its lipid modification, and is released from the cell membrane, leading to the subsequent disruption of actin cytoskeleton of the host cell.

Belongs to the peptidase C58 family.

36.308 kDa

MNSIHGHYHIQLSNYSAGENLQSATLTEGVIGAHRVKVETALSHSNLQKKLSATIKHNQSGRSMLDRKLTSDGKANQRSSFTFSMIMYRMIHFVLSTRVPAVRESVANYGGNINFKFAQTKGAFLHKIIKHSDTASGVCEALCAHWIRSHAQGQSLFDQLYVGGRKGKFQIDTLYSIKQLQIDGCKADVDQDEVTLDWFKKNGISERMIERHCLLRPVDVTGTTESEGLDQLLNAILDTHGIGYGYKKIHLSGQMSAHAIAAYVNEKSGVTFFDPNFGEFHFSDKEKFRKWFTNSFWGNSMYHYPLGVGQRFRVLTFDSKEV

yopT

Cysteine protease YopT

322 amino acids

Cysteine protease, which is translocated into infected cells and plays a central role in pathogenesis by cleaving the C-terminus end of the human small GTPase RhoA/ARHA, a regulator of cytoskeleton. Once cleaved, ARHA loses its lipid modification, and is released from the cell membrane, leading to the subsequent disruption of actin cytoskeleton of the host cell.

Belongs to the peptidase C58 family.

36.366 kDa

MNSIHGHYHIQLSNYSAGENLQSATLTEGVIGAHRVKVETALSHSNLQKKLSATIKHNQSGRSMLDRKLTSDGKANQRSSFTFSMIMYRMIHFVLSTRVPAVRESVANYGGNINFKFAQTKGAFLHKIIKHSDTASGVCEALCAHWIRSHAQGQSLFDQLYVGGRKGKFQIDTLYSIKQLQIDGCKADVDQDEVTLDWFKKNGISERMIERHCLLRPVDVTGTTESEGLDQLLNAILDTHGIGYGYKKIHLSGQMSAHAIAAYVNEKSGVTFFDPNFGEFHFSDKEKFRKWFTNSFWDNSMYHYPLGVGQRFRVLTFDSKEV

yopT

SPbeta prophage-derived uncharacterized protein YopT

72 amino acids

8.078 kDa

MAGYLNNIALNLEIVLKNKADSPEVSETLVTRICENLLLSKEVSFLKADGSVENFKLSDMEYEITNTEELPE