About Products Protein Database Contact

ylxM

Gene
ylxM
Protein
UPF0122 protein YlxM
Organism
Bacillus subtilis (strain 168)
Length
110 amino acids
Function
Might take part in the signal recognition particle (SRP) pathway. This is inferred from the conservation of its genetic proximity to ftsY/ffh. May be a regulatory protein.
Similarity
Belongs to the UPF0122 family.
Mass
13.165 kDa
Sequence
MSLEKTTRMNYLFDFYQSLLTSKQKSYMSLYYLDDFSLGEIAEEYEVSRQAVYDNIKRTEAMLEQYEEKLLLLKKFQERKEMFNKLKELASGSKEEEEITALIEALEKLD

Gene
ylxM
Protein
UPF0122 protein SMU_1061
Organism
Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Length
110 amino acids
Function
Might take part in the signal recognition particle (SRP) pathway. This is inferred from the conservation of its genetic proximity to ftsY/ffh. May be a regulatory protein.
Similarity
Belongs to the UPF0122 family.
Mass
13.252 kDa
Sequence
MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFDVSRQAVYDNIKRTEKILEDYEMKLHMYSDYVVRSEIFDAIMKKYPNDPYLQNKISILTTIDNRD