About Products Protein Database Contact

yjiH

Gene
yjiH
Protein
Uncharacterized protein YjiH
Organism
Escherichia coli (strain K12)
Length
227 amino acids
Mass
23.793 kDa
Sequence
MTQQGDAVAGELATEKVGIKGYLAFFLTIIFFSGVFSGTDSWWRVFDFSVLNGSFGQLPGANGATTSFRGAGGAGAKDGFLFALELAPSVILSLGIISITDGLGGLRAAQQLMTPVLKPLLGIPGICSLALIANLQNTDAAAGMTKELAQEGEITERDKVIFAAYQTSGSAIITNYFSSGVAVFAFLGTSVIVPLAVILVFKFVGANILRVWLNFEERRNPTQGAQA